PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS74456.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family GRAS
Protein Properties Length: 371aa    MW: 40965.9 Da    PI: 6.9311
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS74456.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS319.76.2e-98113702374
        GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNq 100
                 v+ L+++Ae v++g+  la+++Larl+++ sp g+p++R+a++ +eAL++ l +      +a +p + s+   + ++ a+klfse+sP+++f+++taNq
  EPS74456.1  11 VDHLYKAAELVQTGNSILAHEILARLNHHLSPVGRPFHRAAFHCKEALQQLLRN-----GDAPHPPPPSPFGLVFKVGAYKLFSEISPVVQFANFTANQ 104
                 6789************************************************99.....6666666666677*************************** PP

        GRAS 101 aIleavegeervHiiDfdisqGlQWpaLlqaLasRp.egppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkp 198
                 a+leav+g +++Hi+Dfdi++G+QW++L+q++  R  +++ps++iT++ sp ++++ el  ++e+L +fA+e+++pfef+++  ++l +  ++ L  ++
  EPS74456.1 105 AVLEAVDGFDAIHIVDFDIGYGVQWASLMQEIGLRGgSSTPSVKITAFISPGTHDQLELGLIRENLIHFASEVNIPFEFQAIGIDSLGSSGPWLLPESK 203
                 ***********************************978899******************************************************7766 PP

        GRAS 199 ..gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsl.eaklpreseerikvErellgrei 294
                   +E +aVnl +   +l       +s  +++L+++k+lsP++vv ve  +d+++ sF++++++ l+ +s l++sl +++l+ ++++ +k+Er+ll+++i
  EPS74456.1 204 aeDEGVAVNLPFG--SL-------PSSMPSILSFLKRLSPRIVVSVETGCDRTDLSFADHVVHVLQSHSDLLESLdAVNLHMNNDALQKIERFLLKPAI 293
                 67**********3..33.......344556*********************************************999********************* PP

        GRAS 295 vnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                 + +va++ ++     +  ++W++ l ++GF+pv +s+ +++qa++++++ +++g+rve+++ sl+l+W++++L+svSaWr
  EPS74456.1 294 ERAVAARFRS---PDKAQQHWKSLLLSCGFSPVMFSSLTESQAECVVKRSPVRGFRVEKSQSSLLLCWQKKELLSVSAWR 370
                 ******9998...667789************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098544.3141350IPR005202Transcription factor GRAS
PfamPF035142.1E-9511370IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007623Biological Processcircadian rhythm
GO:0048768Biological Processroot hair cell tip growth
GO:0051301Biological Processcell division
Sequence ? help Back to Top
Protein Sequence    Length: 371 aa     Download sequence    Send to blast
HHHHYQQAVV VDHLYKAAEL VQTGNSILAH EILARLNHHL SPVGRPFHRA AFHCKEALQQ  60
LLRNGDAPHP PPPSPFGLVF KVGAYKLFSE ISPVVQFANF TANQAVLEAV DGFDAIHIVD  120
FDIGYGVQWA SLMQEIGLRG GSSTPSVKIT AFISPGTHDQ LELGLIRENL IHFASEVNIP  180
FEFQAIGIDS LGSSGPWLLP ESKAEDEGVA VNLPFGSLPS SMPSILSFLK RLSPRIVVSV  240
ETGCDRTDLS FADHVVHVLQ SHSDLLESLD AVNLHMNNDA LQKIERFLLK PAIERAVAAR  300
FRSPDKAQQH WKSLLLSCGF SPVMFSSLTE SQAECVVKRS PVRGFRVEKS QSSLLLCWQK  360
KELLSVSAWR C
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-372837021375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011090295.11e-174PREDICTED: scarecrow-like protein 6
SwissprotO813161e-128SCL6_ARATH; Scarecrow-like protein 6
TrEMBLS8DAD50.0S8DAD5_9LAMI; Uncharacterized protein (Fragment)
STRINGPGSC0003DMT4000667991e-164(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA62532235
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00150.11e-129GRAS family protein
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]